(data stored in ACNUC7421 zone)

EMBL: CR954246.PE203

CR954246.PE203       Location/Qualifiers
FT   CDS             222904..223650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0214"
FT                   /product="putative sugar-phosphate aldolase"
FT                   /function="2.1.3.1 : Carbohydrates (other than glucose)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8939754; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85317"
FT                   /db_xref="GOA:Q3ILQ8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ8"
FT                   /protein_id="CAI85317.1"
FT                   /translation="MIKQQKEAALAVALMDLTSLNSNDDSAAINTLVNSINPKLGTPAA
FT                   VCVYSDFVAEAKIALATRELSHIKVATVTNFPTGDAPLNTVINETLIAIERGADEIDLV
FT                   IPYKALIAGDKSRVLEYVTESKKVCGSRALLKVIIESGELQTPDLIASATLLAIKGGAD
FT                   FVKTSTGKVAVNATLDATKTILNTIKESGKLVGFKAAGGVKTVADASDYLTLASTIMGN
FT                   DYLQANTFRFGASSLLTNVYAVLNEA"
     MIKQQKEAAL AVALMDLTSL NSNDDSAAIN TLVNSINPKL GTPAAVCVYS DFVAEAKIAL        60
     ATRELSHIKV ATVTNFPTGD APLNTVINET LIAIERGADE IDLVIPYKAL IAGDKSRVLE       120
     YVTESKKVCG SRALLKVIIE SGELQTPDLI ASATLLAIKG GADFVKTSTG KVAVNATLDA       180
     TKTILNTIKE SGKLVGFKAA GGVKTVADAS DYLTLASTIM GNDYLQANTF RFGASSLLTN       240
     VYAVLNEA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page