(data stored in ACNUC7421 zone)

EMBL: CR954246.PE204

CR954246.PE204       Location/Qualifiers
FT   CDS             223694..224140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0215"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ7"
FT                   /protein_id="CAI85318.1"
FT                   /translation="MFLRCYEQQYGIHMRHIWHNEPNKPDVSCYKGDQQLDIEVAHLYA
FT                   SETEAMAVLGRPLSIPMQRALADMAQAPSEQRLRLALERLLEQKATKSYHSARTWLLIR
FT                   NASTIWHKADFDAQLKMISVPQTHAFEQIWLLRDFYRGELVRLF"
     MFLRCYEQQY GIHMRHIWHN EPNKPDVSCY KGDQQLDIEV AHLYASETEA MAVLGRPLSI        60
     PMQRALADMA QAPSEQRLRL ALERLLEQKA TKSYHSARTW LLIRNASTIW HKADFDAQLK       120
     MISVPQTHAF EQIWLLRDFY RGELVRLF                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page