(data stored in ACNUC7421 zone)

EMBL: CR954246.PE229

CR954246.PE229       Location/Qualifiers
FT   CDS             253820..255028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0240"
FT                   /product="putative general secretion pathway protein L"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85343"
FT                   /db_xref="GOA:Q3ILN2"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN2"
FT                   /protein_id="CAI85343.1"
FT                   /translation="MTEILLIRTGQTEQELLNWLIYSPQEQQIIASGELVNASYLNELS
FT                   EKSLGREVVVLLPCDQVQLKTVMLPTKWNRKLEQALPYMLEEDIACDIDELFIAVGEPV
FT                   MIGEQHAVRVAMTDREWFEAWLALFAEHNLSVYKILPDALLLPPADEDTVTAIALNNQW
FT                   LFKQGPWRISAVETSWLNGYLTAMGNPDVKHFSPATQFPETVNLQAQTSDYDLPLALFA
FT                   KQLEHTKFNLRQGMYQLKKKSTLWWGYWKSAAIITSVALVASITIKAIELHQLNTQLEL
FT                   AKAQVIERYQKAFPGTKVRPHLIKNQIKGALAKIQDTSDAGFLELTTELVGVFSQVSNF
FT                   TPETLRYDKKRNELRMRARAKDFQTFGKVKAILEQQGLTVDQGSLSNDGDFVVGEIKLR
FT                   GAV"
     MTEILLIRTG QTEQELLNWL IYSPQEQQII ASGELVNASY LNELSEKSLG REVVVLLPCD        60
     QVQLKTVMLP TKWNRKLEQA LPYMLEEDIA CDIDELFIAV GEPVMIGEQH AVRVAMTDRE       120
     WFEAWLALFA EHNLSVYKIL PDALLLPPAD EDTVTAIALN NQWLFKQGPW RISAVETSWL       180
     NGYLTAMGNP DVKHFSPATQ FPETVNLQAQ TSDYDLPLAL FAKQLEHTKF NLRQGMYQLK       240
     KKSTLWWGYW KSAAIITSVA LVASITIKAI ELHQLNTQLE LAKAQVIERY QKAFPGTKVR       300
     PHLIKNQIKG ALAKIQDTSD AGFLELTTEL VGVFSQVSNF TPETLRYDKK RNELRMRARA       360
     KDFQTFGKVK AILEQQGLTV DQGSLSNDGD FVVGEIKLRG AV                          402
//

If you have problems or comments...

PBIL Back to PBIL home page