(data stored in ACNUC7421 zone)

EMBL: CR954246.PE230

CR954246.PE230       Location/Qualifiers
FT   CDS             255025..255498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0241"
FT                   /product="putative general secretion pathway protein M"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85344"
FT                   /db_xref="GOA:Q3ILM0"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM0"
FT                   /protein_id="CAI85344.1"
FT                   /translation="MKQQLIKHWRSLKEQEQQLIIVASGIFIVFILVMGIFRPLNNAIA
FT                   SAEQSQLKQQELLVWVDESIVKLKAAGNTQVVNSQNISQIVNATRGRYKINISKMQPSN
FT                   NSLRLTLDSVEFNQLILWLDELVNQHGLRVENLDLSRDDKSGYVRVSRLLLEK"
     MKQQLIKHWR SLKEQEQQLI IVASGIFIVF ILVMGIFRPL NNAIASAEQS QLKQQELLVW        60
     VDESIVKLKA AGNTQVVNSQ NISQIVNATR GRYKINISKM QPSNNSLRLT LDSVEFNQLI       120
     LWLDELVNQH GLRVENLDLS RDDKSGYVRV SRLLLEK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page