(data stored in ACNUC7421 zone)

EMBL: CR954246.PE231

CR954246.PE231       Location/Qualifiers
FT   CDS             255502..256260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0242"
FT                   /product="putative general secretion pathway protein N"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85345"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN0"
FT                   /protein_id="CAI85345.1"
FT                   /translation="MKKIITLSIVFLLSFIVFCIIKLPVAVAIDLAKPYFPKQLEVGQS
FT                   VGTIWQGQMMQVRYQGEQLNNVRWDVAGWALFTGKLNANVKFGDPRERSDISGYADVSF
FT                   GLFNKQVKVTNGLVRSTVERAMQRIQLPLPVTAKGRVILELAEYTSGAPYCESLQGEIA
FT                   SPNIDVQGLNGWFNIGPLGGNLSCKSGDIAILIDPDNTLGLEADATLKANFDFKVSGYV
FT                   KPDATLPKDVHDAVKFLGRPDNQGRYPLNF"
     MKKIITLSIV FLLSFIVFCI IKLPVAVAID LAKPYFPKQL EVGQSVGTIW QGQMMQVRYQ        60
     GEQLNNVRWD VAGWALFTGK LNANVKFGDP RERSDISGYA DVSFGLFNKQ VKVTNGLVRS       120
     TVERAMQRIQ LPLPVTAKGR VILELAEYTS GAPYCESLQG EIASPNIDVQ GLNGWFNIGP       180
     LGGNLSCKSG DIAILIDPDN TLGLEADATL KANFDFKVSG YVKPDATLPK DVHDAVKFLG       240
     RPDNQGRYPL NF                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page