(data stored in ACNUC7421 zone)

EMBL: CR954246.PE232

CR954246.PE232       Location/Qualifiers
FT   CDS             256282..256869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0243"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85346"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM9"
FT                   /protein_id="CAI85346.1"
FT                   /translation="MQLPQFTEQHAKQLSTFLDTQSQAMTLTQSQGYLFGVICSPEPLD
FT                   VHEWMAAILPNTANNVDEEMLFLFMALYHQISEQVFEVGYKLPAQYNYEFCSNWSAGFV
FT                   TATTSYTQKLLSSTALEAEYKQALESAQATLSFFALDGQTISQIALQNSIDEQLLCQQQ
FT                   YELMGDFALGFAELVEIVALNSGLYTDEGWEE"
     MQLPQFTEQH AKQLSTFLDT QSQAMTLTQS QGYLFGVICS PEPLDVHEWM AAILPNTANN        60
     VDEEMLFLFM ALYHQISEQV FEVGYKLPAQ YNYEFCSNWS AGFVTATTSY TQKLLSSTAL       120
     EAEYKQALES AQATLSFFAL DGQTISQIAL QNSIDEQLLC QQQYELMGDF ALGFAELVEI       180
     VALNSGLYTD EGWEE                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page