(data stored in ACNUC7421 zone)

EMBL: CR954246.PE235

CR954246.PE235       Location/Qualifiers
FT   CDS             257764..259194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0246"
FT                   /product="conserved protein of unknown function ; putative
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85349"
FT                   /db_xref="GOA:Q3ILM6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM6"
FT                   /protein_id="CAI85349.1"
FT                   /translation="MDKQIKVKNIPVEVKIQKPDLSGQQDRFNPRNRIYVRAVNGLHQL
FT                   LRQRIGFLGLLAFMLLPWINFNGEQAVLFDLIGQKYNIFGLTLWPQDFTILAFIFMLAA
FT                   FALFLVTTFYGRVWCGYTCPQTVWTFTFIWFEEKFEGTANQRKKLDQRAMDFDKFWRKT
FT                   AKHTSWILFSLYTAITFVGYFTPIRELLPDFVTFNAGSYALMSIIFFAACTYGNAGWMR
FT                   EIMCLHICPYSRFQSAMFDKDTYTVSYDEKRGESRGPRSRKVAHQDLEIGDCIDCNLCV
FT                   QVCPTGIDIRNGLQAECINCGACIDACDGVMDKMNYPRGLISYTTERNLETPENKTNPL
FT                   RAKIIGYIVILVILTSALVANIALRKTMEFDIIRDRNQLYRVDFEGLVENTYTLKVINK
FT                   AQYEQTFTIKVQGLDNFKYIGKQTFRVNAGQSHNVPLSLVMDPYDLKAPMTEFNFVLSP
FT                   VGEPDNQISQSSNFFKAR"
     MDKQIKVKNI PVEVKIQKPD LSGQQDRFNP RNRIYVRAVN GLHQLLRQRI GFLGLLAFML        60
     LPWINFNGEQ AVLFDLIGQK YNIFGLTLWP QDFTILAFIF MLAAFALFLV TTFYGRVWCG       120
     YTCPQTVWTF TFIWFEEKFE GTANQRKKLD QRAMDFDKFW RKTAKHTSWI LFSLYTAITF       180
     VGYFTPIREL LPDFVTFNAG SYALMSIIFF AACTYGNAGW MREIMCLHIC PYSRFQSAMF       240
     DKDTYTVSYD EKRGESRGPR SRKVAHQDLE IGDCIDCNLC VQVCPTGIDI RNGLQAECIN       300
     CGACIDACDG VMDKMNYPRG LISYTTERNL ETPENKTNPL RAKIIGYIVI LVILTSALVA       360
     NIALRKTMEF DIIRDRNQLY RVDFEGLVEN TYTLKVINKA QYEQTFTIKV QGLDNFKYIG       420
     KQTFRVNAGQ SHNVPLSLVM DPYDLKAPMT EFNFVLSPVG EPDNQISQSS NFFKAR           476
//

If you have problems or comments...

PBIL Back to PBIL home page