(data stored in ACNUC7421 zone)

EMBL: CR954246.PE24

CR954246.PE24        Location/Qualifiers
FT   CDS             27007..28128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0024"
FT                   /product="conserved protein of unknown function ; putative
FT                   LysM domain protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85138"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI1"
FT                   /protein_id="CAI85138.1"
FT                   /translation="MKSPLIAIIVALGAAFSTYADVLKIKKDAPKQYVVKKGDTLWDIS
FT                   GVYLNEPWLWPELWQLNPQINNPHLIYPGDALALIYDAQGNPRLVINKAYRKLSPQGRI
FT                   TPKGKNAITTLPLEMIRPYITYEQAINSDDIKAKPYILGANENTKTQTLGHILYVKGDL
FT                   KLHQAYAIYHKGKPYLDPETGRVLANRAAYVGMARAFRKGDAANGEPASVRVESVKREI
FT                   KQGDFLLPAMEGQMLPAYFNMHRPTQAVLGYVIASPSDSREFSTMDVVVLNLGSEQQVE
FT                   VGHVLDIERQSPSVIDGPRGPRYTEDSSRFEKLISNANEFFGAEPDDGSTVWKMPKEKV
FT                   GELIVFKVYDNVSYALITKNQHPIRVGDIAVIH"
     MKSPLIAIIV ALGAAFSTYA DVLKIKKDAP KQYVVKKGDT LWDISGVYLN EPWLWPELWQ        60
     LNPQINNPHL IYPGDALALI YDAQGNPRLV INKAYRKLSP QGRITPKGKN AITTLPLEMI       120
     RPYITYEQAI NSDDIKAKPY ILGANENTKT QTLGHILYVK GDLKLHQAYA IYHKGKPYLD       180
     PETGRVLANR AAYVGMARAF RKGDAANGEP ASVRVESVKR EIKQGDFLLP AMEGQMLPAY       240
     FNMHRPTQAV LGYVIASPSD SREFSTMDVV VLNLGSEQQV EVGHVLDIER QSPSVIDGPR       300
     GPRYTEDSSR FEKLISNANE FFGAEPDDGS TVWKMPKEKV GELIVFKVYD NVSYALITKN       360
     QHPIRVGDIA VIH                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page