(data stored in ACNUC7421 zone)

EMBL: CR954246.PE240

CR954246.PE240       Location/Qualifiers
FT   CDS             262872..263999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0251"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85354"
FT                   /db_xref="InterPro:IPR041651"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM1"
FT                   /protein_id="CAI85354.1"
FT                   /translation="MKIGNFGFVPNHNINKYGNKGALQQPTIQSPQDNYQQRGKELAAK
FT                   VLGDKMAQALGLPISEPKKDKPLFDFDEIVKNVLDFVTSAVRKAKANGADDEKLKGMLG
FT                   DARKGVQIGIDDAVDELKGNGVFNDDIAQGINKSKEGIFNGLDKFEDDLFNPKPASVSV
FT                   SQAQYASLSNKAEYKFTTAEGDEVSISFADAYESQSASRYQQNGNSESFVSESSQSREL
FT                   SFSMSVNGDLNENEQKAINELMADLQSVSSTFFSGDLDKAFEEAQALSLGNEQLVAFSM
FT                   DLRQTKTVATVKGYEEYKPVPEKAVADKLAPFNDDLKAVFNKATELGIQNQLSGIVQWL
FT                   NQDQAEIDKLVDYTKAMFENLNQLNAATDELANQQ"
     MKIGNFGFVP NHNINKYGNK GALQQPTIQS PQDNYQQRGK ELAAKVLGDK MAQALGLPIS        60
     EPKKDKPLFD FDEIVKNVLD FVTSAVRKAK ANGADDEKLK GMLGDARKGV QIGIDDAVDE       120
     LKGNGVFNDD IAQGINKSKE GIFNGLDKFE DDLFNPKPAS VSVSQAQYAS LSNKAEYKFT       180
     TAEGDEVSIS FADAYESQSA SRYQQNGNSE SFVSESSQSR ELSFSMSVNG DLNENEQKAI       240
     NELMADLQSV SSTFFSGDLD KAFEEAQALS LGNEQLVAFS MDLRQTKTVA TVKGYEEYKP       300
     VPEKAVADKL APFNDDLKAV FNKATELGIQ NQLSGIVQWL NQDQAEIDKL VDYTKAMFEN       360
     LNQLNAATDE LANQQ                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page