(data stored in ACNUC7421 zone)

EMBL: CR954246.PE242

CR954246.PE242       Location/Qualifiers
FT   CDS             complement(264837..265316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0253"
FT                   /product="conserved protein of unknown function ; putative
FT                   RNA-binding domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85356"
FT                   /db_xref="GOA:Q3IDS6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS6"
FT                   /protein_id="CAI85356.1"
FT                   /translation="MKLPDQKSFILSVILAVVGFVIVKFALESLELDPALLFAVGLLIG
FT                   GIVIAAMSSDGVVEAEVKTKTLYVGNLPYRANEGVVRALFEEQGKVFNVRLLKDKNTGK
FT                   RRGFGFVEMAQADADNAIAQLNDSEFQQRTLKVREAKQKQEDDSNALRSEPDQSV"
     MKLPDQKSFI LSVILAVVGF VIVKFALESL ELDPALLFAV GLLIGGIVIA AMSSDGVVEA        60
     EVKTKTLYVG NLPYRANEGV VRALFEEQGK VFNVRLLKDK NTGKRRGFGF VEMAQADADN       120
     AIAQLNDSEF QQRTLKVREA KQKQEDDSNA LRSEPDQSV                              159
//

If you have problems or comments...

PBIL Back to PBIL home page