(data stored in ACNUC7421 zone)

EMBL: CR954246.PE246

CR954246.PE246       Location/Qualifiers
FT   CDS             complement(274850..275326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0261"
FT                   /product="putative FxsA protein (Suppressor of F exclusion
FT                   of phage T7)"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10497016, 10497017; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85360"
FT                   /db_xref="GOA:Q3IDT5"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT5"
FT                   /protein_id="CAI85360.1"
FT                   /translation="MFRFLFVLFIIIPIIEIALLIQVSEVIGGFSTIALVIITAILGAK
FT                   MVKQQGMSALQKAQTQMAEGQMPAKELFTGICVIIAGVLLLTPGIMTDVFGLLLLTPVI
FT                   RNKLAAGLASQATVRMSAGMQQGGSPFTQHSQTEADPHQVNKPTIIDGEFERKD"
     MFRFLFVLFI IIPIIEIALL IQVSEVIGGF STIALVIITA ILGAKMVKQQ GMSALQKAQT        60
     QMAEGQMPAK ELFTGICVII AGVLLLTPGI MTDVFGLLLL TPVIRNKLAA GLASQATVRM       120
     SAGMQQGGSP FTQHSQTEAD PHQVNKPTII DGEFERKD                               158
//

If you have problems or comments...

PBIL Back to PBIL home page