(data stored in ACNUC7421 zone)

EMBL: CR954246.PE252

CR954246.PE252       Location/Qualifiers
FT   CDS             280312..280788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0267"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85366"
FT                   /db_xref="GOA:Q3IDU1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDU1"
FT                   /protein_id="CAI85366.1"
FT                   /translation="MSRSFKSHLSDDIATVTMGNRIAAIIEQGAVIYLHGDLGAGKTTF
FT                   TRGIVQGFGHTGKVKSPTYTLVEPYELERANVYHFDLYRLGDPEELEYMGIRDYFSAQA
FT                   ICVVEWPEKGGEFIPVPDLNITLSYVGDERNIVINSASERGSVIIEKLNNLTSE"
     MSRSFKSHLS DDIATVTMGN RIAAIIEQGA VIYLHGDLGA GKTTFTRGIV QGFGHTGKVK        60
     SPTYTLVEPY ELERANVYHF DLYRLGDPEE LEYMGIRDYF SAQAICVVEW PEKGGEFIPV       120
     PDLNITLSYV GDERNIVINS ASERGSVIIE KLNNLTSE                               158
//

If you have problems or comments...

PBIL Back to PBIL home page