(data stored in ACNUC7421 zone)

EMBL: CR954246.PE261

CR954246.PE261       Location/Qualifiers
FT   CDS             290672..291310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0276"
FT                   /product="Sodium-type polar flagellar protein motX"
FT                   /function="1.5.3 : Motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85375"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ2"
FT                   /protein_id="CAI85375.1"
FT                   /translation="MQLLFSHSVLLLPLMTLSLLMSSNSLAEETAAAVPLYTETELISL
FT                   INKNTHLARVKADDCQLVQDIEARANKMALPSYQFLYGDMLAYNVCVDRDVELGVYYMQ
FT                   KAAEQGLAAALEQLGRYYDIGRLVQQDKAMAITYLREASSQGNLKAQFRLVKLFNQGYG
FT                   SPRDFEDMYRWLFYAKVADANTHKKIERLLAQLAEKMPASVVARARLPM"
     MQLLFSHSVL LLPLMTLSLL MSSNSLAEET AAAVPLYTET ELISLINKNT HLARVKADDC        60
     QLVQDIEARA NKMALPSYQF LYGDMLAYNV CVDRDVELGV YYMQKAAEQG LAAALEQLGR       120
     YYDIGRLVQQ DKAMAITYLR EASSQGNLKA QFRLVKLFNQ GYGSPRDFED MYRWLFYAKV       180
     ADANTHKKIE RLLAQLAEKM PASVVARARL PM                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page