(data stored in ACNUC7421 zone)

EMBL: CR954246.PE263

CR954246.PE263       Location/Qualifiers
FT   CDS             293261..293410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0278"
FT                   /product="putative membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85377"
FT                   /db_xref="GOA:Q3IEZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ0"
FT                   /protein_id="CAI85377.1"
FT                   /translation="MIDKSITYVNYNTGVYTDKLNFANRILAVYQILRVLKSVILSVIL
FT                   INTL"
     MIDKSITYVN YNTGVYTDKL NFANRILAVY QILRVLKSVI LSVILINTL                    49
//

If you have problems or comments...

PBIL Back to PBIL home page