(data stored in ACNUC7421 zone)

EMBL: CR954246.PE266

CR954246.PE266       Location/Qualifiers
FT   CDS             296932..297318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0281"
FT                   /product="putative orphan protein ; putative signal
FT                   peptide"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85380"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY6"
FT                   /protein_id="CAI85380.1"
FT                   /translation="MKKYALVLMVLLVGCANSSDEQPYEINNKQFHEKQDEQGNKLFAY
FT                   VVSVKAKSRQNINLDKKFTRSDFERFAAQEHFEESSILKLQLEDQAVELLNKELETRNY
FT                   CPAKHEINEVLWRDLSVQLRGRCL"
     MKKYALVLMV LLVGCANSSD EQPYEINNKQ FHEKQDEQGN KLFAYVVSVK AKSRQNINLD        60
     KKFTRSDFER FAAQEHFEES SILKLQLEDQ AVELLNKELE TRNYCPAKHE INEVLWRDLS       120
     VQLRGRCL                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page