(data stored in ACNUC7421 zone)

EMBL: CR954246.PE267

CR954246.PE267       Location/Qualifiers
FT   CDS             297320..297820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0282"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85381"
FT                   /db_xref="GOA:Q3IEY5"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY5"
FT                   /protein_id="CAI85381.1"
FT                   /translation="MLADKTKLAALLAQLNINYEVIEHPPLHGSLDADAFMVERPGTRL
FT                   KNLFLRDNEGKRHFLVITAHDKQLDLKVLSKQQGLSRLGFASSERLARYLKVAPGCVSM
FT                   LSLMNDKQNEVSVWLDQDIWQGELFHCHPFENTQTWLLNKADLEQFFNFTEHQPRVVFL
FT                   PSR"
     MLADKTKLAA LLAQLNINYE VIEHPPLHGS LDADAFMVER PGTRLKNLFL RDNEGKRHFL        60
     VITAHDKQLD LKVLSKQQGL SRLGFASSER LARYLKVAPG CVSMLSLMND KQNEVSVWLD       120
     QDIWQGELFH CHPFENTQTW LLNKADLEQF FNFTEHQPRV VFLPSR                      166
//

If you have problems or comments...

PBIL Back to PBIL home page