(data stored in ACNUC7421 zone)

EMBL: CR954246.PE268

CR954246.PE268       Location/Qualifiers
FT   CDS             complement(297787..298935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0283"
FT                   /product="putative transport protein (MFS family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85382"
FT                   /db_xref="GOA:Q3IEY4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY4"
FT                   /protein_id="CAI85382.1"
FT                   /translation="MRLPHLLLCSVFIFFVLYAPQPLLGLFAVEFGVAPAAAGSLMTAA
FT                   MLPLAIAPLVYGLFLTKRNPLFILRIAMLLLGGCCLLFVYAPTFELLLLVRFLQGLILP
FT                   AALTAMTSYIGMSFSADTLQKNMTIYIGSTIVGGYFGRVLAAIFSDIWHWQSFYYFIAT
FT                   MLILLAWSIPHTRFKSNNVKSILSPLDYIKQLREGPLLKVYGAVFCMFFCFAALLNYLP
FT                   FILQNTFLITNTRDIGLVYSGYLIGALASITTPWLLKKVPSAWHLLTAIFLFYSISIVM
FT                   LMSHQLIVFLAAFTLFCGSMFVIHSTAAPLVNKISKAPPSVTNGGYVSFYYSGGALGSL
FT                   LPGVIYQHHGQTAFMAALLAVCLCGLMLVIWAYLEGKNTTRG"
     MRLPHLLLCS VFIFFVLYAP QPLLGLFAVE FGVAPAAAGS LMTAAMLPLA IAPLVYGLFL        60
     TKRNPLFILR IAMLLLGGCC LLFVYAPTFE LLLLVRFLQG LILPAALTAM TSYIGMSFSA       120
     DTLQKNMTIY IGSTIVGGYF GRVLAAIFSD IWHWQSFYYF IATMLILLAW SIPHTRFKSN       180
     NVKSILSPLD YIKQLREGPL LKVYGAVFCM FFCFAALLNY LPFILQNTFL ITNTRDIGLV       240
     YSGYLIGALA SITTPWLLKK VPSAWHLLTA IFLFYSISIV MLMSHQLIVF LAAFTLFCGS       300
     MFVIHSTAAP LVNKISKAPP SVTNGGYVSF YYSGGALGSL LPGVIYQHHG QTAFMAALLA       360
     VCLCGLMLVI WAYLEGKNTT RG                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page