(data stored in ACNUC7421 zone)

EMBL: CR954246.PE269

CR954246.PE269       Location/Qualifiers
FT   CDS             299201..299740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0284"
FT                   /product="conserved protein of unknown function ; putative
FT                   nucleoprotein/polynucleotide-associated enzyme"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85383"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY3"
FT                   /protein_id="CAI85383.1"
FT                   /translation="MGSLQEQLLQAGLTTSHKAKVAKSEKRKQQKKQKKGATSNPSDLQ
FT                   KHIQQTKLEQQQKAEELNQARQGSLKQREQSARVKQILEHHNQEAIRGERTFNFTYENK
FT                   VKSIEVNERTQKALSGGRLAICVLEGRFYVLEDEPARKVAEVDEHYIVFHVEPESKVKD
FT                   EDDPYADFEIPDDLTW"
     MGSLQEQLLQ AGLTTSHKAK VAKSEKRKQQ KKQKKGATSN PSDLQKHIQQ TKLEQQQKAE        60
     ELNQARQGSL KQREQSARVK QILEHHNQEA IRGERTFNFT YENKVKSIEV NERTQKALSG       120
     GRLAICVLEG RFYVLEDEPA RKVAEVDEHY IVFHVEPESK VKDEDDPYAD FEIPDDLTW        179
//

If you have problems or comments...

PBIL Back to PBIL home page