(data stored in ACNUC7421 zone)

EMBL: CR954246.PE27

CR954246.PE27        Location/Qualifiers
FT   CDS             30253..30828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0027"
FT                   /product="putative DNA topoisomerase; C4 zinc finger domain
FT                   protein"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85141"
FT                   /db_xref="GOA:Q3IDH8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH8"
FT                   /protein_id="CAI85141.1"
FT                   /translation="MSKIDHSLFSANKHALEKEYEICPQCGSELVIRNSKSGPFLGCAS
FT                   YPKCDFIRPLAHHDSSEIKVLEDSACPQCSKQLVVKNGRYGMFIGCTGYPECHYIANEN
FT                   EAKQNEEPLPSCPKCKKGRLVSRSNKFGKIFYSCDCYPSCKYTLNNKPVEQSCPECNWP
FT                   LLIERKMANSTVLQCPQKSCMHKLAATE"
     MSKIDHSLFS ANKHALEKEY EICPQCGSEL VIRNSKSGPF LGCASYPKCD FIRPLAHHDS        60
     SEIKVLEDSA CPQCSKQLVV KNGRYGMFIG CTGYPECHYI ANENEAKQNE EPLPSCPKCK       120
     KGRLVSRSNK FGKIFYSCDC YPSCKYTLNN KPVEQSCPEC NWPLLIERKM ANSTVLQCPQ       180
     KSCMHKLAAT E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page