(data stored in ACNUC7421 zone)

EMBL: CR954246.PE270

CR954246.PE270       Location/Qualifiers
FT   CDS             299916..300239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0285"
FT                   /product="putative cytochrome c4 family"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85384"
FT                   /db_xref="GOA:Q3IEY2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY2"
FT                   /protein_id="CAI85384.1"
FT                   /translation="MSKIKTLLLGAGISLAASLSFNAAAADGAALYTAKNCQTCHGAEG
FT                   KAPIMGMYPKLNGQNKDYLVAQMKDIKSGARSNGMSMAMKAMVATVTDEEFAAIADYLA
FT                   NVK"
     MSKIKTLLLG AGISLAASLS FNAAAADGAA LYTAKNCQTC HGAEGKAPIM GMYPKLNGQN        60
     KDYLVAQMKD IKSGARSNGM SMAMKAMVAT VTDEEFAAIA DYLANVK                     107
//

If you have problems or comments...

PBIL Back to PBIL home page