(data stored in ACNUC7421 zone)

EMBL: CR954246.PE271

CR954246.PE271       Location/Qualifiers
FT   CDS             300382..301149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0286"
FT                   /product="conserved protein of unknown function ; putative
FT                   aldolase class II family"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="4.1.2.-"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85385"
FT                   /db_xref="GOA:Q3IEY1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY1"
FT                   /protein_id="CAI85385.1"
FT                   /translation="MFDLPQLDLKNKVSAQEWQLRVDLAACYRLVDHFRWGDLIYTHLS
FT                   ARIPGSDHYLVNAFGLTFDEISASNLVKVDLSGNIIDDTPFNINPAGFTIHSAIHEVRD
FT                   DAHCVIHLHTKETIAVATQKNGLLPLSQYSMFSLPSLSYHGYEGLAVNDDERKRLQDDL
FT                   GNTNHMLLVNHGGLTVGPTVGDAFMRFYDLQRACEIQLAIQASSQQAISVPQPIIDNIY
FT                   NQANVVHSGSTGGQLAWPAMLRKAYRLDPSFAK"
     MFDLPQLDLK NKVSAQEWQL RVDLAACYRL VDHFRWGDLI YTHLSARIPG SDHYLVNAFG        60
     LTFDEISASN LVKVDLSGNI IDDTPFNINP AGFTIHSAIH EVRDDAHCVI HLHTKETIAV       120
     ATQKNGLLPL SQYSMFSLPS LSYHGYEGLA VNDDERKRLQ DDLGNTNHML LVNHGGLTVG       180
     PTVGDAFMRF YDLQRACEIQ LAIQASSQQA ISVPQPIIDN IYNQANVVHS GSTGGQLAWP       240
     AMLRKAYRLD PSFAK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page