(data stored in ACNUC7421 zone)

EMBL: CR954246.PE272

CR954246.PE272       Location/Qualifiers
FT   CDS             301177..302352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0287"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme family"
FT                   /EC_number="5.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85386"
FT                   /db_xref="GOA:Q3IEY0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY0"
FT                   /protein_id="CAI85386.1"
FT                   /translation="MKVNRVEVFDIHCPDRPAWTPVFVRIHTDEGISGVGEAGLAYDLG
FT                   HSAAAAMIKEMADAFLIGHDPFQTEKLWSRMLRESFWGLGGGPVVYAAMSAIDTALWDI
FT                   KGKALGVPVYQLLGGKVNDKLRTYASQLQFDWDSEFKALVQPQEYAEAALKAVAEGYDA
FT                   VKVDPIQYDKDGNTYYDRTNIISRAEMKLYRARMQAIREAVGDEVDIIFECHSLPGVTS
FT                   AIQLGEIAKEFDCMFFEEPVNYLNHSLHAKVADKVAVPIAGGERLYNRWGVRPYLEDQS
FT                   INVLQPDIGLCGGFTETKKVCDYADIFDVRIQAHVCGGPVATAASLHLETAIPNFLIHE
FT                   HHTYAIKKWNRELCLQDPQPKNGFFQVSEEPGIGIELNDEIVMRSQRVEIK"
     MKVNRVEVFD IHCPDRPAWT PVFVRIHTDE GISGVGEAGL AYDLGHSAAA AMIKEMADAF        60
     LIGHDPFQTE KLWSRMLRES FWGLGGGPVV YAAMSAIDTA LWDIKGKALG VPVYQLLGGK       120
     VNDKLRTYAS QLQFDWDSEF KALVQPQEYA EAALKAVAEG YDAVKVDPIQ YDKDGNTYYD       180
     RTNIISRAEM KLYRARMQAI REAVGDEVDI IFECHSLPGV TSAIQLGEIA KEFDCMFFEE       240
     PVNYLNHSLH AKVADKVAVP IAGGERLYNR WGVRPYLEDQ SINVLQPDIG LCGGFTETKK       300
     VCDYADIFDV RIQAHVCGGP VATAASLHLE TAIPNFLIHE HHTYAIKKWN RELCLQDPQP       360
     KNGFFQVSEE PGIGIELNDE IVMRSQRVEI K                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page