(data stored in ACNUC7421 zone)

EMBL: CR954246.PE274

CR954246.PE274       Location/Qualifiers
FT   CDS             complement(302810..304375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0289"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85388"
FT                   /db_xref="GOA:Q3IEX8"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX8"
FT                   /protein_id="CAI85388.1"
FT                   /translation="MHSKIRDKKTTTLASLALLSVLSGCGGGSDSEGLTPNSNTNSWSA
FT                   GVFASASQFKGQCQASNEKNWLRSWSNETYLWYDEIIDTDPALTSGVVAYFNTLKTNEL
FT                   TDSGAKKDNYHFNLPTDEWQRQSQSGVTYGYGFNIKILASSAPRQAVISYTEPNTPASN
FT                   QNLARGFELVAVDGIDFVNTTSSSEVALISASLFPEQTGKTTEFVFKDINTNQNRTVTL
FT                   TSQNITSQPVVNVRTDLADGDVGYFQFNSHNAIAEDQLYNAFNQFAASNIKDLVIDVRY
FT                   NGGGFLQMASQVAYMIAGRANTQGKVFERTVFNDKNPNTNPVTGQTLSPMPFTNQFVGF
FT                   ADNPATVPGSALPTLNLNRVFVLTTSSTCSASEAIINGLRGADIEVIQIGSGTCGKPYG
FT                   FYPTDNCATTYFTIQFSGINNKGFGEYADGFAPKNTIDNAFQPVLLNGCALADDFSQPL
FT                   GNANEALLKTALNYRNTGSCPAPSSINSKQGFAPAITTDSPEVKDTRIQTLLEQNTILS
FT                   DNMR"
     MHSKIRDKKT TTLASLALLS VLSGCGGGSD SEGLTPNSNT NSWSAGVFAS ASQFKGQCQA        60
     SNEKNWLRSW SNETYLWYDE IIDTDPALTS GVVAYFNTLK TNELTDSGAK KDNYHFNLPT       120
     DEWQRQSQSG VTYGYGFNIK ILASSAPRQA VISYTEPNTP ASNQNLARGF ELVAVDGIDF       180
     VNTTSSSEVA LISASLFPEQ TGKTTEFVFK DINTNQNRTV TLTSQNITSQ PVVNVRTDLA       240
     DGDVGYFQFN SHNAIAEDQL YNAFNQFAAS NIKDLVIDVR YNGGGFLQMA SQVAYMIAGR       300
     ANTQGKVFER TVFNDKNPNT NPVTGQTLSP MPFTNQFVGF ADNPATVPGS ALPTLNLNRV       360
     FVLTTSSTCS ASEAIINGLR GADIEVIQIG SGTCGKPYGF YPTDNCATTY FTIQFSGINN       420
     KGFGEYADGF APKNTIDNAF QPVLLNGCAL ADDFSQPLGN ANEALLKTAL NYRNTGSCPA       480
     PSSINSKQGF APAITTDSPE VKDTRIQTLL EQNTILSDNM R                           521
//

If you have problems or comments...

PBIL Back to PBIL home page