(data stored in ACNUC7421 zone)

EMBL: CR954246.PE275

CR954246.PE275       Location/Qualifiers
FT   CDS             complement(304425..305264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0290"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85389"
FT                   /db_xref="GOA:Q3IEX7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX7"
FT                   /protein_id="CAI85389.1"
FT                   /translation="MSRAIIDPHVHFFNLLEGQYTWLQGANPPPWPNLDKIKQPISAAQ
FT                   LMQDCDFKLAGLVHIEAGFDNSAPINELNWLTKHLAGITYKAVSFAQIDQSNQLFSHAL
FT                   SNLSHPSLAGIRDITQGDDAKRLLSSNCYNNFETLQQLKLHFEAQFELENHIIVKQIAQ
FT                   YAKQFPQLQIILNHAGLPHNMPAWQQGIKLLAKYHNIAIKFSGFELLKLNSGQQAQCFN
FT                   IILQHFGEQRIMFASNFPVCQINTQYNDLWQAHFNLCSNQALWQQLSYKNAKHCYQL"
     MSRAIIDPHV HFFNLLEGQY TWLQGANPPP WPNLDKIKQP ISAAQLMQDC DFKLAGLVHI        60
     EAGFDNSAPI NELNWLTKHL AGITYKAVSF AQIDQSNQLF SHALSNLSHP SLAGIRDITQ       120
     GDDAKRLLSS NCYNNFETLQ QLKLHFEAQF ELENHIIVKQ IAQYAKQFPQ LQIILNHAGL       180
     PHNMPAWQQG IKLLAKYHNI AIKFSGFELL KLNSGQQAQC FNIILQHFGE QRIMFASNFP       240
     VCQINTQYND LWQAHFNLCS NQALWQQLSY KNAKHCYQL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page