(data stored in ACNUC7421 zone)

EMBL: CR954246.PE276

CR954246.PE276       Location/Qualifiers
FT   CDS             complement(305261..305989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0291"
FT                   /product="putative glucose/ribitol dehydrogenase family"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85390"
FT                   /db_xref="GOA:Q3IEW4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW4"
FT                   /protein_id="CAI85390.1"
FT                   /translation="MSKVAIVTGGTKGIGLAVVQRLLASGYEVHNLDITPSNFGEFHHC
FT                   DVSDVTVVRHCINAIVEQTQRIDVLVSNAGKHLSANIESTDEQTLDALFALNVKGAYAA
FT                   VQSVLPIMKTQNNGAIVLIASDQAIIGKKNSFAYNLTKHALASMAKTTALDYASFNIRA
FT                   NAVCPGTIETPLFHNAIDAYCKNSGANKAQTVAEEAALQPLNRLGQADEVAALVNFLVS
FT                   DDASFITGSLQSIDGGYTAQ"
     MSKVAIVTGG TKGIGLAVVQ RLLASGYEVH NLDITPSNFG EFHHCDVSDV TVVRHCINAI        60
     VEQTQRIDVL VSNAGKHLSA NIESTDEQTL DALFALNVKG AYAAVQSVLP IMKTQNNGAI       120
     VLIASDQAII GKKNSFAYNL TKHALASMAK TTALDYASFN IRANAVCPGT IETPLFHNAI       180
     DAYCKNSGAN KAQTVAEEAA LQPLNRLGQA DEVAALVNFL VSDDASFITG SLQSIDGGYT       240
     AQ                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page