(data stored in ACNUC7421 zone)

EMBL: CR954246.PE279

CR954246.PE279       Location/Qualifiers
FT   CDS             complement(308112..309128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0294"
FT                   /product="putative orphan protein ; putative
FT                   beta-lactamase-like domain ; putative signal peptide"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85393"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX4"
FT                   /protein_id="CAI85393.1"
FT                   /translation="MKSALRLFKLSKYLLLLNSFYFAANANADVTWEKISPNIQFLKQQ
FT                   HKLRFYDSNQVLIEGSKCALLVDTSGNFAAVEQLASDLKKHLTTPLCYLVATHFHDDHL
FT                   LGMAVMQHFYPDAQLITHQQVKTDFALYQQAFNDKLEGFEKSIELSYQRLATLPENEQA
FT                   QWRTKLERAKQRLFRWQKYQLNAPEISINTNKTLDLGNFEITLNAHQAHTNGDLTITTN
FT                   SGSTLIGGDIVDWLPYPGHGELSSWRALLQQYINDSVLKTIIPGHGELTNKSQLQQSHA
FT                   FLTAITEHVANNSGQTIEQLMLSFPDVAIKPYMQESLNAKSSNLFLQAGLIRAINAK"
     MKSALRLFKL SKYLLLLNSF YFAANANADV TWEKISPNIQ FLKQQHKLRF YDSNQVLIEG        60
     SKCALLVDTS GNFAAVEQLA SDLKKHLTTP LCYLVATHFH DDHLLGMAVM QHFYPDAQLI       120
     THQQVKTDFA LYQQAFNDKL EGFEKSIELS YQRLATLPEN EQAQWRTKLE RAKQRLFRWQ       180
     KYQLNAPEIS INTNKTLDLG NFEITLNAHQ AHTNGDLTIT TNSGSTLIGG DIVDWLPYPG       240
     HGELSSWRAL LQQYINDSVL KTIIPGHGEL TNKSQLQQSH AFLTAITEHV ANNSGQTIEQ       300
     LMLSFPDVAI KPYMQESLNA KSSNLFLQAG LIRAINAK                               338
//

If you have problems or comments...

PBIL Back to PBIL home page