(data stored in ACNUC7421 zone)

EMBL: CR954246.PE28

CR954246.PE28        Location/Qualifiers
FT   CDS             30853..31416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0028"
FT                   /product="putative double-stranded RNA-binding protein with
FT                   unique protein fold, with YrdC/RibB domain"
FT                   /function="3.2.1.1.2 : Regulatory proteins (RNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85142"
FT                   /db_xref="GOA:Q3IDH7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDH7"
FT                   /protein_id="CAI85142.1"
FT                   /translation="MSDQSTIAAAITCLAQGEVILYPTEAVYGLGCDPDNQQAVERLLA
FT                   IKQRPVEKGLILIADNYGQLLKYVDDAKIPMDKRADIFSSWPNAITWVMPAAKNTPKWL
FT                   TGQYDTIAVRVTNHPTVKRLCQEFGKPLVSTSANLSGQNTVLSIAEAKSQFTEQIGYYV
FT                   DEPLGGNTQPSTIKDAMNGKVFRG"
     MSDQSTIAAA ITCLAQGEVI LYPTEAVYGL GCDPDNQQAV ERLLAIKQRP VEKGLILIAD        60
     NYGQLLKYVD DAKIPMDKRA DIFSSWPNAI TWVMPAAKNT PKWLTGQYDT IAVRVTNHPT       120
     VKRLCQEFGK PLVSTSANLS GQNTVLSIAE AKSQFTEQIG YYVDEPLGGN TQPSTIKDAM       180
     NGKVFRG                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page