(data stored in ACNUC7421 zone)

EMBL: CR954246.PE280

CR954246.PE280       Location/Qualifiers
FT   CDS             complement(309188..309493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0295"
FT                   /product="conserved protein of unknown function; putative
FT                   FtsZ-associated protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85394"
FT                   /db_xref="GOA:Q3IEX3"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX3"
FT                   /protein_id="CAI85394.1"
FT                   /translation="MSELQNQRVTVELLGKEQQFACPPGQEEALKAAAKNLNDLVEQMK
FT                   QRSTVKNEQNALLMAALNLSHELLEAKTIKAVDLQHQDQLIDKLSQHLSNDSKHNK"
     MSELQNQRVT VELLGKEQQF ACPPGQEEAL KAAAKNLNDL VEQMKQRSTV KNEQNALLMA        60
     ALNLSHELLE AKTIKAVDLQ HQDQLIDKLS QHLSNDSKHN K                           101
//

If you have problems or comments...

PBIL Back to PBIL home page