(data stored in ACNUC7421 zone)

EMBL: CR954246.PE283

CR954246.PE283       Location/Qualifiers
FT   CDS             309962..310801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0298"
FT                   /product="conserved protein of unknown function ; putative"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85397"
FT                   /db_xref="GOA:Q3IEX0"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX0"
FT                   /protein_id="CAI85397.1"
FT                   /translation="MLSYRHSFHAGNPADVLKHLVLAQVLGYQTLKDKPLDYIDTHSGA
FT                   GFFELAAADAQKTQEYQDGIEKLWQHTSKHSALNDYIALIKSFNQTANLEFYPGSPKIA
FT                   EHFLRRQDKGWFFELHPRDLLLLEENMQGKRSIRVRGENGFAGLVGLLPPASRRACVLI
FT                   DPPYEVKDDYDTVITTLMQAYQRFATGTYMIWYPVVDRSRIDNMEQDLIDSGMRNIQLF
FT                   ELATKADTDVHGMTASGMIVINPPWKLKQVMDEVLPELVSILSESSGFYRSEQLVAE"
     MLSYRHSFHA GNPADVLKHL VLAQVLGYQT LKDKPLDYID THSGAGFFEL AAADAQKTQE        60
     YQDGIEKLWQ HTSKHSALND YIALIKSFNQ TANLEFYPGS PKIAEHFLRR QDKGWFFELH       120
     PRDLLLLEEN MQGKRSIRVR GENGFAGLVG LLPPASRRAC VLIDPPYEVK DDYDTVITTL       180
     MQAYQRFATG TYMIWYPVVD RSRIDNMEQD LIDSGMRNIQ LFELATKADT DVHGMTASGM       240
     IVINPPWKLK QVMDEVLPEL VSILSESSGF YRSEQLVAE                              279
//

If you have problems or comments...

PBIL Back to PBIL home page