(data stored in ACNUC7421 zone)

EMBL: CR954246.PE284

CR954246.PE284       Location/Qualifiers
FT   CDS             complement(310858..311667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0299"
FT                   /product="conserved protein of unknown function ; putative
FT                   lipoprotein precursor"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85398"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW9"
FT                   /protein_id="CAI85398.1"
FT                   /translation="MFKRKPSSILKSVAGISFLASGALVLSGCDDAKNTAQATQAESTA
FT                   TLTTEVSYLDRSMLAPNSQLTVTLADVSKMDIKATVISQQVIDLNGGPPYTVELAYDTN
FT                   KINKALSYSVSARIENNGELLYTSTSNNNPFAADAQTSPYKIVVTKVDQKPDVDLANTY
FT                   WKAITLAGDNVTVTTKEPFIQFSNDGKVHGFLGCNNFNGGYEVNEQTVTFDHIAATQKM
FT                   CHENMDQEAAMSSMLSKAAQWQVNGESLSLKDEKGEQLATFKAVYFN"
     MFKRKPSSIL KSVAGISFLA SGALVLSGCD DAKNTAQATQ AESTATLTTE VSYLDRSMLA        60
     PNSQLTVTLA DVSKMDIKAT VISQQVIDLN GGPPYTVELA YDTNKINKAL SYSVSARIEN       120
     NGELLYTSTS NNNPFAADAQ TSPYKIVVTK VDQKPDVDLA NTYWKAITLA GDNVTVTTKE       180
     PFIQFSNDGK VHGFLGCNNF NGGYEVNEQT VTFDHIAATQ KMCHENMDQE AAMSSMLSKA       240
     AQWQVNGESL SLKDEKGEQL ATFKAVYFN                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page