(data stored in ACNUC7421 zone)

EMBL: CR954246.PE285

CR954246.PE285       Location/Qualifiers
FT   CDS             complement(311815..312381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0300"
FT                   /product="conserved protein of unknown function ; putative
FT                   PhnA protein(yjdM)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 2155230; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85399"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW8"
FT                   /protein_id="CAI85399.1"
FT                   /translation="MSIEQALVERSNNQCELCAATDTLSVYEVPPVKEAHSDKCIYTCQ
FT                   VCKDQIEDTAELTPTHWHCLNDSMWSQTPAVQVVAYRMLSRLAADNGWAQDALDMIYLE
FT                   EDTLAWAQQVLAEDDDLKHLDSNGVVLKAGDTVTLIKDLDVKGSSLTAKRGTAVRNIGL
FT                   TSNPEHIEGRVDGQRIVILTKFVKK"
     MSIEQALVER SNNQCELCAA TDTLSVYEVP PVKEAHSDKC IYTCQVCKDQ IEDTAELTPT        60
     HWHCLNDSMW SQTPAVQVVA YRMLSRLAAD NGWAQDALDM IYLEEDTLAW AQQVLAEDDD       120
     LKHLDSNGVV LKAGDTVTLI KDLDVKGSSL TAKRGTAVRN IGLTSNPEHI EGRVDGQRIV       180
     ILTKFVKK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page