(data stored in ACNUC7421 zone)

EMBL: CR954246.PE286

CR954246.PE286       Location/Qualifiers
FT   CDS             312623..313231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0301"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85400"
FT                   /db_xref="GOA:Q3IEW7"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW7"
FT                   /protein_id="CAI85400.1"
FT                   /translation="MRLLLPIVSILIALVLLVPGVTQPVLSLEGKIDKSKLAQTGIEMI
FT                   ADEGDRNTRNMLMMASSMFGLDKLEGEISAYQKTRSIWGTVNELAHNKNYLVAVLVAFF
FT                   SIVIPTIKLLMQLVFCLLPASKFKQNLGVTICALSKWSMVDVFVIALIVTYLAGNAEGE
FT                   TGGLIKMHAELGNGFWYFTGYCLFAIAASSFIKTDAKNI"
     MRLLLPIVSI LIALVLLVPG VTQPVLSLEG KIDKSKLAQT GIEMIADEGD RNTRNMLMMA        60
     SSMFGLDKLE GEISAYQKTR SIWGTVNELA HNKNYLVAVL VAFFSIVIPT IKLLMQLVFC       120
     LLPASKFKQN LGVTICALSK WSMVDVFVIA LIVTYLAGNA EGETGGLIKM HAELGNGFWY       180
     FTGYCLFAIA ASSFIKTDAK NI                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page