(data stored in ACNUC7421 zone)

EMBL: CR954246.PE287

CR954246.PE287       Location/Qualifiers
FT   CDS             313369..313740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0302"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW6"
FT                   /protein_id="CAI85401.1"
FT                   /translation="MQRIYSSLLIIAMLLTLVGQAVASVAMLCEMPHMSQTQHAATNVA
FT                   TEKVHQQMSVSMMNMDCCDDAATEQECNCPINACSAYSMLSVDGLFSTPLIISEKIQLY
FT                   PSQNQHHLVSSLYRPPMSA"
     MQRIYSSLLI IAMLLTLVGQ AVASVAMLCE MPHMSQTQHA ATNVATEKVH QQMSVSMMNM        60
     DCCDDAATEQ ECNCPINACS AYSMLSVDGL FSTPLIISEK IQLYPSQNQH HLVSSLYRPP       120
     MSA                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page