(data stored in ACNUC7421 zone)

EMBL: CR954246.PE288

CR954246.PE288       Location/Qualifiers
FT   CDS             313832..315157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0303"
FT                   /product="putative outer membrane cation efflux protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85402"
FT                   /db_xref="GOA:Q3IEW5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW5"
FT                   /protein_id="CAI85402.1"
FT                   /translation="MNHFAVFKVSFLALMLGTAISAHSNELSLDEALSYALNHEPWLKA
FT                   SQYQQASEQAQSIAAGSLPDPVLTLGLMGVPTDGFALDQEGMTQLSIGVSQMFSRGDSL
FT                   ALKQQALAQSAQQHPWLRADRLAQVKTIVIESWLNAYRAQRSIALIEQDKALFSQLIDI
FT                   TESSYASSLGKTRQQDIIRAQLELTRLEDKLVMLAQQLESAKKRLSQWLPMSMLTQPVS
FT                   TKNTAIEPLISFTTLEFEALMSLLMAHPAIVAIDQTVTAKQTEIALAKQSYKPQFGVNM
FT                   GYSHRGDTPMGDSRADLLSVGVSIDLPLFTSNRQDQQVNAAIATAEAVKTQKLIALQKL
FT                   KGMYFKEFSQLMQLQKRDTLYQTKLLPQMAEQAQATLNAYTRDDGDFSEVMRARISELN
FT                   AKIDGLNIQIDQQIIIARLNYYASSQDAAVMLEQLGEQNREY"
     MNHFAVFKVS FLALMLGTAI SAHSNELSLD EALSYALNHE PWLKASQYQQ ASEQAQSIAA        60
     GSLPDPVLTL GLMGVPTDGF ALDQEGMTQL SIGVSQMFSR GDSLALKQQA LAQSAQQHPW       120
     LRADRLAQVK TIVIESWLNA YRAQRSIALI EQDKALFSQL IDITESSYAS SLGKTRQQDI       180
     IRAQLELTRL EDKLVMLAQQ LESAKKRLSQ WLPMSMLTQP VSTKNTAIEP LISFTTLEFE       240
     ALMSLLMAHP AIVAIDQTVT AKQTEIALAK QSYKPQFGVN MGYSHRGDTP MGDSRADLLS       300
     VGVSIDLPLF TSNRQDQQVN AAIATAEAVK TQKLIALQKL KGMYFKEFSQ LMQLQKRDTL       360
     YQTKLLPQMA EQAQATLNAY TRDDGDFSEV MRARISELNA KIDGLNIQID QQIIIARLNY       420
     YASSQDAAVM LEQLGEQNRE Y                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page