(data stored in ACNUC7421 zone)

EMBL: CR954246.PE289

CR954246.PE289       Location/Qualifiers
FT   CDS             315147..316895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0304"
FT                   /product="putative cation efflux system protein"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12813074; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85403"
FT                   /db_xref="GOA:Q3ILD2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD2"
FT                   /protein_id="CAI85403.1"
FT                   /translation="MNTNLKLLIAAVVGGGVTALVLSLMPASNTDIKASTEKQPLYWVA
FT                   PMDSNYRRDEPGLSPMGMDLVPFYDEAPGSSSNLDGPGAVTISPAVVNNLGVRIAKVQH
FT                   KALQNEVKTVGYVQYNQDQLIHIHPRVEGWLETLYIKAAGDSVEHGEPLYTLYSPQLVN
FT                   AQEEFLLALNRNNQVLIRAAKARLKSLNISDDFVERLQKSKQVMQNITFYAIQSGVVEE
FT                   LNVREGFYVNPGTTMMSIGKLDEVWVEAQVFERQAELIKIGQPVSMTLDYLSGQSWQGK
FT                   VDYIYPTLDAKNRTLRVRLRFNNEGHKLKPNMFAQVNIHTQANKAQLVVPKEAVIRTGN
FT                   QNRVVVALGEGRFKSVAVEMGRSDSKNTAILSGIMADDDVVVSAQFLLDSESSKSSDFK
FT                   RMQAPQAVSSVWSEGIVNSIMAEHRMVNISHEPIAELDWPSMTMDFTVADDVDFTAFEN
FT                   GQTLHFELTKQADGSYVLTAIHIMKSTVTNSEKNTATVLGTINSIDKAQRIANISRGAI
FT                   EKWGREPARLDFTFADDIDLTALAAQQQINFTFSLQQGEFVISHINGEHSTSASGNHTM
FT                   QLHNAH"
     MNTNLKLLIA AVVGGGVTAL VLSLMPASNT DIKASTEKQP LYWVAPMDSN YRRDEPGLSP        60
     MGMDLVPFYD EAPGSSSNLD GPGAVTISPA VVNNLGVRIA KVQHKALQNE VKTVGYVQYN       120
     QDQLIHIHPR VEGWLETLYI KAAGDSVEHG EPLYTLYSPQ LVNAQEEFLL ALNRNNQVLI       180
     RAAKARLKSL NISDDFVERL QKSKQVMQNI TFYAIQSGVV EELNVREGFY VNPGTTMMSI       240
     GKLDEVWVEA QVFERQAELI KIGQPVSMTL DYLSGQSWQG KVDYIYPTLD AKNRTLRVRL       300
     RFNNEGHKLK PNMFAQVNIH TQANKAQLVV PKEAVIRTGN QNRVVVALGE GRFKSVAVEM       360
     GRSDSKNTAI LSGIMADDDV VVSAQFLLDS ESSKSSDFKR MQAPQAVSSV WSEGIVNSIM       420
     AEHRMVNISH EPIAELDWPS MTMDFTVADD VDFTAFENGQ TLHFELTKQA DGSYVLTAIH       480
     IMKSTVTNSE KNTATVLGTI NSIDKAQRIA NISRGAIEKW GREPARLDFT FADDIDLTAL       540
     AAQQQINFTF SLQQGEFVIS HINGEHSTSA SGNHTMQLHN AH                          582
//

If you have problems or comments...

PBIL Back to PBIL home page