(data stored in ACNUC7421 zone)

EMBL: CR954246.PE291

CR954246.PE291       Location/Qualifiers
FT   CDS             320162..320617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0306"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85405"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD0"
FT                   /protein_id="CAI85405.1"
FT                   /translation="MQVKTIQQMYDWTILFHTQMAANFFSVRELLGEHNTQLVDYCTKY
FT                   EKKLAEDLIGFKAITTINTLDTYCYEYFAENPELLNFTDLDRSTQLDEQAIQGYLSDQH
FT                   QKVINAYEYLEGKTQTADGKEKLGQILQLEYQGLKQMVQSINRHIDM"
     MQVKTIQQMY DWTILFHTQM AANFFSVREL LGEHNTQLVD YCTKYEKKLA EDLIGFKAIT        60
     TINTLDTYCY EYFAENPELL NFTDLDRSTQ LDEQAIQGYL SDQHQKVINA YEYLEGKTQT       120
     ADGKEKLGQI LQLEYQGLKQ MVQSINRHID M                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page