(data stored in ACNUC7421 zone)

EMBL: CR954246.PE293

CR954246.PE293       Location/Qualifiers
FT   CDS             complement(320884..321390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0308"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85407"
FT                   /db_xref="GOA:Q3ILC8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC8"
FT                   /protein_id="CAI85407.1"
FT                   /translation="MKQLVITILGQDRPGLVESISSVILENHGNWLSSNLSHLLGHFAG
FT                   IIQIEVSEEHFQALQNALNALPKLDVRIETGNTEIEPATREQLNFVITGNDRPGIVQEL
FT                   ASVIRHKGANITHLNSRQQSAPNWGVPIFSAVATVTLPNGLNKEEVINALESITSDLIV
FT                   DVEKV"
     MKQLVITILG QDRPGLVESI SSVILENHGN WLSSNLSHLL GHFAGIIQIE VSEEHFQALQ        60
     NALNALPKLD VRIETGNTEI EPATREQLNF VITGNDRPGI VQELASVIRH KGANITHLNS       120
     RQQSAPNWGV PIFSAVATVT LPNGLNKEEV INALESITSD LIVDVEKV                    168
//

If you have problems or comments...

PBIL Back to PBIL home page