(data stored in ACNUC7421 zone)

EMBL: CR954246.PE298

CR954246.PE298       Location/Qualifiers
FT   CDS             327389..328066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0313"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85412"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC3"
FT                   /protein_id="CAI85412.1"
FT                   /translation="MQTNAFLGVFAKSPIKPMEEHIRKVHQASKALIPFFNHVFKEEWQ
FT                   QAEELRLTIRNLEREADEMKRNIRLQLPRGLFMPVERTDLLELVTQQDKIANKAKDIAG
FT                   RVIGREMIIPKVIQIDFLAYLTRCVDATKQASNAINELEELLETGFKGREVALVEKMLV
FT                   ELDAIEQDTDEMQIKIRRQLRAVEGELNPVDVMFLYKIIEWVGELADIAERVGSRLELM
FT                   LAR"
     MQTNAFLGVF AKSPIKPMEE HIRKVHQASK ALIPFFNHVF KEEWQQAEEL RLTIRNLERE        60
     ADEMKRNIRL QLPRGLFMPV ERTDLLELVT QQDKIANKAK DIAGRVIGRE MIIPKVIQID       120
     FLAYLTRCVD ATKQASNAIN ELEELLETGF KGREVALVEK MLVELDAIEQ DTDEMQIKIR       180
     RQLRAVEGEL NPVDVMFLYK IIEWVGELAD IAERVGSRLE LMLAR                       225
//

If you have problems or comments...

PBIL Back to PBIL home page