(data stored in ACNUC7421 zone)

EMBL: CR954246.PE299

CR954246.PE299       Location/Qualifiers
FT   CDS             328169..329374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0314"
FT                   /product="putative inorganic phosphate transporter"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85413"
FT                   /db_xref="GOA:Q3ILC2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC2"
FT                   /protein_id="CAI85413.1"
FT                   /translation="MAYGIGANDVANAMGTSVGSKALTIKQAIFIAMIFEFAGAYLAGG
FT                   EVTSTIRNGIIDSTPFMDIPELMILGMISALFAAGAWLLMASFLGWPVSTTHSIIGAII
FT                   GFALVAVGSEAIHWNKVAGIVGSWIVTPAISGFIAYLIFMSAQKLIFDTATPLKNAKRF
FT                   VPIYMGLAGFIMSLVTIKKGLKHIGINLGTVEGISLSIAIAVVVGFIGKIAISRLKIDP
FT                   QADKKMQFNNVEKVFAVLMVLTACCMAFAHGSNDVANAIGPLAAVVSIVENNGEIAKQA
FT                   AIAWWILPLGGFGIVAGLAILGKKVIKTIGEGITHLTPSRGFAAELAAASTVVIASGTG
FT                   LPISTTQTLVGAVLGVGMARGIAALNMGVIRNIVVSWVITLPVGAGLAIVIFYVLRTAF
FT                   GV"
     MAYGIGANDV ANAMGTSVGS KALTIKQAIF IAMIFEFAGA YLAGGEVTST IRNGIIDSTP        60
     FMDIPELMIL GMISALFAAG AWLLMASFLG WPVSTTHSII GAIIGFALVA VGSEAIHWNK       120
     VAGIVGSWIV TPAISGFIAY LIFMSAQKLI FDTATPLKNA KRFVPIYMGL AGFIMSLVTI       180
     KKGLKHIGIN LGTVEGISLS IAIAVVVGFI GKIAISRLKI DPQADKKMQF NNVEKVFAVL       240
     MVLTACCMAF AHGSNDVANA IGPLAAVVSI VENNGEIAKQ AAIAWWILPL GGFGIVAGLA       300
     ILGKKVIKTI GEGITHLTPS RGFAAELAAA STVVIASGTG LPISTTQTLV GAVLGVGMAR       360
     GIAALNMGVI RNIVVSWVIT LPVGAGLAIV IFYVLRTAFG V                           401
//

If you have problems or comments...

PBIL Back to PBIL home page