(data stored in ACNUC7421 zone)

EMBL: CR954246.PE30

CR954246.PE30        Location/Qualifiers
FT   CDS             complement(32430..32867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0030"
FT                   /product="putative hemoglobin-like oxygen-binding protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11900532, 11796724; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85144"
FT                   /db_xref="GOA:Q3IDI7"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="PDB:4UUR"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI7"
FT                   /protein_id="CAI85144.1"
FT                   /translation="MIKRLFSKSKPATIEQTPTPEKTPYEILGGEAGALAIANRFYDIM
FT                   ATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQD
FT                   LRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH"
     MIKRLFSKSK PATIEQTPTP EKTPYEILGG EAGALAIANR FYDIMATDEY AKPLYDMHPL        60
     PLDRIRQVFF EFLSGWLGGP DLFVAKHGHP MLRKRHMPFT IDQDLRDQWM YCMNKTLDLE       120
     VDNPLLREGL KQSFGQLASH MINQH                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page