(data stored in ACNUC7421 zone)

EMBL: CR954246.PE300

CR954246.PE300       Location/Qualifiers
FT   CDS             329457..330395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0315"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85414"
FT                   /db_xref="GOA:Q3ILC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC1"
FT                   /protein_id="CAI85414.1"
FT                   /translation="MTNLPSIKQLQYLLAVHQYQHFGRAASACFIGQSTLSTAIQNLEE
FT                   TLGCQLIERENRSLMFTTIGEEVVERSRKIIHDTISLKELTKSFLTPLSGKLTVGVIPT
FT                   IASFIAAPLYHFCKQEFCDLELVLVEDTSDKLLDKLEHGQIDLALLALPYQTDKFHTQV
FT                   LARDHFSLVHHKDYTPAKNVQDFNLLPDASVFLLEREHCMTGHALSACHLNRVSCINPF
FT                   EAASLHTLLSMVEYQLGVTFLPQMAINAGILDNKNMLATPSANEAYREIGILWRKTTGR
FT                   IRDFKLFSQQLEVFLKHQCSLDFAKEAATSS"
     MTNLPSIKQL QYLLAVHQYQ HFGRAASACF IGQSTLSTAI QNLEETLGCQ LIERENRSLM        60
     FTTIGEEVVE RSRKIIHDTI SLKELTKSFL TPLSGKLTVG VIPTIASFIA APLYHFCKQE       120
     FCDLELVLVE DTSDKLLDKL EHGQIDLALL ALPYQTDKFH TQVLARDHFS LVHHKDYTPA       180
     KNVQDFNLLP DASVFLLERE HCMTGHALSA CHLNRVSCIN PFEAASLHTL LSMVEYQLGV       240
     TFLPQMAINA GILDNKNMLA TPSANEAYRE IGILWRKTTG RIRDFKLFSQ QLEVFLKHQC       300
     SLDFAKEAAT SS                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page