(data stored in ACNUC7421 zone)

EMBL: CR954246.PE302

CR954246.PE302       Location/Qualifiers
FT   CDS             complement(330808..333339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0317"
FT                   /product="putative orphan protein ; putative sensory-box
FT                   domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85416"
FT                   /db_xref="GOA:Q3ILC0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC0"
FT                   /protein_id="CAI85416.1"
FT                   /translation="MVNQLKLLILNASSAERGTIRATLEKLNVFEFIEVSDSQQALKIL
FT                   KKQAVNIIITGLDVGKIDGWRFSRMIRSGLLNTPKNTPILLIPPIYCERIAETTARSYG
FT                   IDAVLPFERQDMLPQVLASVLANHLEKSSRLNLLLLEPTNTKANEISKPLLLNFSITHV
FT                   TSSQAALNAYNQQQFAIVLLDATAARAEESSVLVSEILQHNPMQAIVTIIDSDDADYAE
FT                   QLLLSGVTDFIRAPYDPPFLNKVCDHAARREDFMVSYAEFANKVEQLSISEVRYRDLFS
FT                   AHQRILLHLNTVVLELDQQGLIRFINPAWEALSGFGVKSTLQQQLTNFCIAECQVKLQA
FT                   TIDDILCGGEYKQQVEIRLQHKNGSQIWVECRLQLIQNSHNNATITATIDNIHERKQAE
FT                   LQLRHLALHDTLTGLHNRYYFDQQLNRICQPQHTHSDIEHALIYIDLDHFKIINDSKGH
FT                   QQGDIVLKEVAQLFITNISTEHLVFRVGGDEFAVILKHTNLLDAHLIAEGICNAIEQNQ
FT                   FKSEEQIYSISCSIGLTQITEKNCDPSECLKQADIALYIAKNLGRNLVHCYAKQDAHNN
FT                   TLQTGLEWGHGIRQALQQDSIELHYQPIWDFRRNEVAYFEVLLRLKINDELVFPNQFIP
FT                   SLEMLNDTFLMDQCVIRNTIANVALYPELNQVAINLSAQSFLDERLVPLIESNLAKYQV
FT                   LPTQIIFEITESASINNLAATRKMIEKLNILGCHFSIDDFGTGFSTFNYLKQLPAQHVK
FT                   IDGSFVCDMLNDPIDLALVKAINDISHSLDKRSVAEYVETEEVFFALKEIGVDYGQGYF
FT                   IARPMPIKGVKSELEKILKNKTFYQQLPSKK"
     MVNQLKLLIL NASSAERGTI RATLEKLNVF EFIEVSDSQQ ALKILKKQAV NIIITGLDVG        60
     KIDGWRFSRM IRSGLLNTPK NTPILLIPPI YCERIAETTA RSYGIDAVLP FERQDMLPQV       120
     LASVLANHLE KSSRLNLLLL EPTNTKANEI SKPLLLNFSI THVTSSQAAL NAYNQQQFAI       180
     VLLDATAARA EESSVLVSEI LQHNPMQAIV TIIDSDDADY AEQLLLSGVT DFIRAPYDPP       240
     FLNKVCDHAA RREDFMVSYA EFANKVEQLS ISEVRYRDLF SAHQRILLHL NTVVLELDQQ       300
     GLIRFINPAW EALSGFGVKS TLQQQLTNFC IAECQVKLQA TIDDILCGGE YKQQVEIRLQ       360
     HKNGSQIWVE CRLQLIQNSH NNATITATID NIHERKQAEL QLRHLALHDT LTGLHNRYYF       420
     DQQLNRICQP QHTHSDIEHA LIYIDLDHFK IINDSKGHQQ GDIVLKEVAQ LFITNISTEH       480
     LVFRVGGDEF AVILKHTNLL DAHLIAEGIC NAIEQNQFKS EEQIYSISCS IGLTQITEKN       540
     CDPSECLKQA DIALYIAKNL GRNLVHCYAK QDAHNNTLQT GLEWGHGIRQ ALQQDSIELH       600
     YQPIWDFRRN EVAYFEVLLR LKINDELVFP NQFIPSLEML NDTFLMDQCV IRNTIANVAL       660
     YPELNQVAIN LSAQSFLDER LVPLIESNLA KYQVLPTQII FEITESASIN NLAATRKMIE       720
     KLNILGCHFS IDDFGTGFST FNYLKQLPAQ HVKIDGSFVC DMLNDPIDLA LVKAINDISH       780
     SLDKRSVAEY VETEEVFFAL KEIGVDYGQG YFIARPMPIK GVKSELEKIL KNKTFYQQLP       840
     SKK                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page