(data stored in ACNUC7421 zone)

EMBL: CR954246.PE309

CR954246.PE309       Location/Qualifiers
FT   CDS             complement(340400..341065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0324"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85423"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB3"
FT                   /protein_id="CAI85423.1"
FT                   /translation="MSVKITDRPQEQVREEVIDQLIYNYSHGVISVEAFERRLDEAMAT
FT                   NNNEVLVSLVEDLTLNTDQQYNAQKHSQFSPNYSAQQFSQSDFTLRSILGSNERSGQWI
FT                   VPKNIYLTNFMGSVVLDFTDAIFTHQEITIHVNCIFGSDEIYVPEHVNVVSKMFSIISS
FT                   VENKTVALNKHQGPTIHIEGKAIMGSVEIKIKRTIKEKFISFANQLKTQLGGKSGTPM"
     MSVKITDRPQ EQVREEVIDQ LIYNYSHGVI SVEAFERRLD EAMATNNNEV LVSLVEDLTL        60
     NTDQQYNAQK HSQFSPNYSA QQFSQSDFTL RSILGSNERS GQWIVPKNIY LTNFMGSVVL       120
     DFTDAIFTHQ EITIHVNCIF GSDEIYVPEH VNVVSKMFSI ISSVENKTVA LNKHQGPTIH       180
     IEGKAIMGSV EIKIKRTIKE KFISFANQLK TQLGGKSGTP M                           221
//

If you have problems or comments...

PBIL Back to PBIL home page