(data stored in ACNUC7421 zone)

EMBL: CR954246.PE311

CR954246.PE311       Location/Qualifiers
FT   CDS             342019..342177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0326"
FT                   /product="conserved protein of unknown function ; putative
FT                   low temperature and salt responsive protein"
FT                   /function="1.3.4 : Other"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 9342870; Product type m :
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85425"
FT                   /db_xref="GOA:Q3IFS2"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS2"
FT                   /protein_id="CAI85425.1"
FT                   /translation="MDIIRIIFSILLPPLGVFLQVGLGLHFWINILLTLFGYFPGVIHA
FT                   IYIIAKK"
     MDIIRIIFSI LLPPLGVFLQ VGLGLHFWIN ILLTLFGYFP GVIHAIYIIA KK                52
//

If you have problems or comments...

PBIL Back to PBIL home page