(data stored in ACNUC7421 zone)

EMBL: CR954246.PE312

CR954246.PE312       Location/Qualifiers
FT   CDS             342908..343633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0327"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85426"
FT                   /db_xref="GOA:Q3IFS1"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS1"
FT                   /protein_id="CAI85426.1"
FT                   /translation="MTPEELEQQAITFAKSNRTRIARKLTDKNEFPSDIRPVSVFMSGS
FT                   PGAGKTETSKAFLEEIGADNVLRLDPDELRELIPGYSGDNSYLFHRAVSFIVERTLDHA
FT                   FKNKQSFLLDGTLASYDVAKKNIERSIRKGRQVLILFVYQKPELAWEFVEAREKLEGRR
FT                   ILPNIFIDQFFASQEVIRELKLNFGSQIQVDLLVKNNKGKTRFYHGNVQAIEHHLDEKF
FT                   TREDLESLIESPSSSKNEL"
     MTPEELEQQA ITFAKSNRTR IARKLTDKNE FPSDIRPVSV FMSGSPGAGK TETSKAFLEE        60
     IGADNVLRLD PDELRELIPG YSGDNSYLFH RAVSFIVERT LDHAFKNKQS FLLDGTLASY       120
     DVAKKNIERS IRKGRQVLIL FVYQKPELAW EFVEAREKLE GRRILPNIFI DQFFASQEVI       180
     RELKLNFGSQ IQVDLLVKNN KGKTRFYHGN VQAIEHHLDE KFTREDLESL IESPSSSKNE       240
     L                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page