(data stored in ACNUC7421 zone)

EMBL: CR954246.PE314

CR954246.PE314       Location/Qualifiers
FT   CDS             complement(343957..344286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0329"
FT                   /product="putative 5-carboxymethyl-2-hydroxymuconate delta
FT                   isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 2194841; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85428"
FT                   /db_xref="GOA:Q3IFR9"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR9"
FT                   /protein_id="CAI85428.1"
FT                   /translation="MPHIIIEHSEDLPVLPQVLVEKIHNAAFQSNLFDLETIKTRAISY
FT                   QQYLLGAGGSGFIHIAVHILAGRSIEQKQMLSEQLLECLKTYCRASDSLSVNIYDIEHE
FT                   IYRKN"
     MPHIIIEHSE DLPVLPQVLV EKIHNAAFQS NLFDLETIKT RAISYQQYLL GAGGSGFIHI        60
     AVHILAGRSI EQKQMLSEQL LECLKTYCRA SDSLSVNIYD IEHEIYRKN                   109
//

If you have problems or comments...

PBIL Back to PBIL home page