(data stored in ACNUC7421 zone)

EMBL: CR954246.PE316

CR954246.PE316       Location/Qualifiers
FT   CDS             344541..345017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0331"
FT                   /product="conserved protein of unknown function ; putative
FT                   CreA protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85430"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR7"
FT                   /protein_id="CAI85430.1"
FT                   /translation="MKYLKVSFLLAGILTLTACSDDVASVSLGLFTTKDVIVNSQQDPL
FT                   VTGVTCHISHIEANLDFSDPSDMSISCRQTGVITAEQLQQIDRSKSGEVVFKSSKSILF
FT                   KSLKVRRIYDAKAHTLLYLSYSTKESTGSHHHALSTVPLYNTQAWQWALGQERE"
     MKYLKVSFLL AGILTLTACS DDVASVSLGL FTTKDVIVNS QQDPLVTGVT CHISHIEANL        60
     DFSDPSDMSI SCRQTGVITA EQLQQIDRSK SGEVVFKSSK SILFKSLKVR RIYDAKAHTL       120
     LYLSYSTKES TGSHHHALST VPLYNTQAWQ WALGQERE                               158
//

If you have problems or comments...

PBIL Back to PBIL home page