(data stored in ACNUC7421 zone)

EMBL: CR954246.PE317

CR954246.PE317       Location/Qualifiers
FT   CDS             345021..345794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0332"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85431"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR6"
FT                   /protein_id="CAI85431.1"
FT                   /translation="MLALFKPKPLLAEQEQQWLIDTFIWAVENFDVEFFTQHTQITLPT
FT                   VEFFPDSVSSIEEMATKVFNRVSSYAGMTAWPIQLVAPQQLTPQVFPQFKFSQQLRGEG
FT                   AKLIVPPSQAINISFNPNQVNQPQDLVASFAGTLATILIHHVGVLPPGGKDYLAQAADA
FT                   LACFLGFGVMMSNTVYQFKGGCGSCYNPYANREASLSETHTVFMHALVSYFKNDKRSKQ
FT                   HLKPHLRGQFKKAQKEIKALVNNSANPLLLAYMPN"
     MLALFKPKPL LAEQEQQWLI DTFIWAVENF DVEFFTQHTQ ITLPTVEFFP DSVSSIEEMA        60
     TKVFNRVSSY AGMTAWPIQL VAPQQLTPQV FPQFKFSQQL RGEGAKLIVP PSQAINISFN       120
     PNQVNQPQDL VASFAGTLAT ILIHHVGVLP PGGKDYLAQA ADALACFLGF GVMMSNTVYQ       180
     FKGGCGSCYN PYANREASLS ETHTVFMHAL VSYFKNDKRS KQHLKPHLRG QFKKAQKEIK       240
     ALVNNSANPL LLAYMPN                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page