(data stored in ACNUC7421 zone)

EMBL: CR954246.PE318

CR954246.PE318       Location/Qualifiers
FT   CDS             345808..346434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0333"
FT                   /product="putative transporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85432"
FT                   /db_xref="GOA:Q3IF04"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF04"
FT                   /protein_id="CAI85432.1"
FT                   /translation="MNYLDEFLLIAVAHFFAVASPGPDFAVVLKQSVQQGRRNALWTSA
FT                   GVGAAILLHVAYCVLGVALILTQSPKVFMGLKYLAGAYLAYLGVQALRAAKPGANLNDN
FT                   IANKTVPAEPVWFAFRRGFLTNALNPKATLFFMSLFTLVISPATPTIVQVSYGVYMALA
FT                   TWAWFSMLSIVLCKTKVRGFFQRSGYWFERCIGVILIALAIRVVI"
     MNYLDEFLLI AVAHFFAVAS PGPDFAVVLK QSVQQGRRNA LWTSAGVGAA ILLHVAYCVL        60
     GVALILTQSP KVFMGLKYLA GAYLAYLGVQ ALRAAKPGAN LNDNIANKTV PAEPVWFAFR       120
     RGFLTNALNP KATLFFMSLF TLVISPATPT IVQVSYGVYM ALATWAWFSM LSIVLCKTKV       180
     RGFFQRSGYW FERCIGVILI ALAIRVVI                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page