(data stored in ACNUC7421 zone)

EMBL: CR954246.PE319

CR954246.PE319       Location/Qualifiers
FT   CDS             346469..346963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0334"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85433"
FT                   /db_xref="GOA:Q3IF03"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF03"
FT                   /protein_id="CAI85433.1"
FT                   /translation="MSLYNFSFGSNMSSHRLLARLPNAKRIGTAVLQGYELTFDMYFKD
FT                   GSGKCSISPSDAEDALVYGVVYQISDAEKVILDGIEGAGYDCVNITVKLLSGEDVNAHC
FT                   YIANTHDSEALPYDWYIKHVHRGALEAGVPKAYSDAILNRAQKSDSNLERAEIEFAVHQ
FT                   K"
     MSLYNFSFGS NMSSHRLLAR LPNAKRIGTA VLQGYELTFD MYFKDGSGKC SISPSDAEDA        60
     LVYGVVYQIS DAEKVILDGI EGAGYDCVNI TVKLLSGEDV NAHCYIANTH DSEALPYDWY       120
     IKHVHRGALE AGVPKAYSDA ILNRAQKSDS NLERAEIEFA VHQK                        164
//

If you have problems or comments...

PBIL Back to PBIL home page